Hefei KS-V Peptide Biological Technology Co., Ltd. http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd. https://www.difficultpeptide.com/ ja-JP INTRODUCTION TO SBDD(2023年05月07日) <p><a href="https://www.difficultpeptide.com/introduction-to-sbdd.html">https://www.difficultpeptide.com/introduction-to-sbdd.html</a></p> <p>Ⅰ.What is SBDD?</p> <p>Structure based drug design (SBDD) is a drug design method based on molecular recognition from the three-dimensional structure of ligands and targets. According to drugs and their targets, such as receptors, enzymes, ion channels, nucleic acids, antigens and viruses, we can find and design reasonable drug molecules.</p> <p>Generally, the steps of SBDD include protein structure preparation, binding site recognition, ligand library preparation, docking and scoring function.</p> <p>Target is the prerequisite of drug design. The selection of reasonable drug target directly determines the success or failure of drug development. The three-dimensional structure of the target can often be obtained by computer model methods such as X-ray crystallography, multi-dimensional nuclear magnetic resonance or homologous protein structure prediction. Secondly, the interaction model between drug and receptor is measured by experimental means or studied by computational method, and the rational drug design is carried out on this basis; In addition to considering the structural characteristics of drugs and receptors, it is also necessary to consider the influence of factors such as drug solubility, toxicity and metabolic process. Reasonable drug design usually requires 10-15 cycles to find the "most suitable" drug molecules.</p> <p>Ⅱ. Advantages and disadvantages of SBDD Technology Platform</p> <p>1. Advantages: low screening cost. Candidate drugs can be obtained from a small number of compounds; It can significantly improve the hit rate of drug discovery; It can directly predict the drug receptor binding energy.</p> <p>2. Deficiency: This design requires a complete and clear three-dimensional structure of the target; it only considers the binding strength of the drug and the receptor, and cannot predict the efficacy of the drug; the speed is slow.</p> <p>If you need any kinds of peptides synthesis, please contact us, as the peptide pharmaceutical companies, KS-V peptide is willing to offer you high quality products.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220824/11/structural-biology.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220824/11/structural-biology.jpg" alt="structural-biology.jpg" /></a></p> 2023-04-23T11:09:02+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/wucQe6cX3gR difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/wucQe6cX3gR#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/wucQe6cX3gR Gene to Structure(2023年05月06日) <p><a href="https://www.difficultpeptide.com/gene-to-structure/">https://www.difficultpeptide.com/gene-to-structure/</a></p> <p>As a professional peptide company in China, we can provide innovative drugs from gene to protein, from gene to structure, from structure to lead compound to new drug preclinical candidate drug and other services, and efficiently promote the discovery of innovative drug candidates.</p> <p>OUR CAPABILITIES IN GENE TO STRUCTURE<br /> ● Construct design with all commercially available vectors<br /> ● Multiple tags, inserts, mutations, deletes, and multi-parallel construct design<br /> ● High capacity protein expression in E Coli, Insect cells, and mammalian cells<br /> ● Automatic protein purification by AKTA.<br /> ● Double stand DNA purification<br /> ● Post-treatment of protein for crystallization: Protein refolding, dephosphorylation, and deglycosylation<br /> ● 13C, 2H, and 15N Labeled proteins for NMR<br /> ● Membrane protein purification from over 70 GPCR stable cell lines, 50 human gene targets.<br /> ● Endotoxin-free protein purification (Final endotoxin as low as 0.1EU/mg)</p> <p>●Off-the-Shelf protein production service</p> <p>OUR ADVANTAGES IN GENE TO STRUCTURE<br /> Our Advantages in Gene to Structure<br /> We have several methods which are used to determine the structure of a biomacromolecule, including Nuclear Magnetic Resonance (NMR) spectroscopy and Cryogenic Electron Microscopy (cryo-EM).</p> <p>We have the most complete and state-of-the-art platform and professional knowledge cluster.</p> <p>After finishing the study, KS-V peptide company will provide you with the confidential structural determination report:</p> <p>–A report of the process of the different phase</p> <p>–Structure confirmation</p> <p>For more information about g2s services and custom synthesis china, please feel free to contact us!</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210719/14/service-content-of-our-peptide-synthesis.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210719/14/service-content-of-our-peptide-synthesis.jpg" alt="service-content-of-our-peptide-synthesis.jpg" /></a></p> 2023-04-23T11:08:35+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/dm6nEBPl3ju difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/dm6nEBPl3ju#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/dm6nEBPl3ju Drug Discovery(2023年05月05日) <p><a href="https://www.difficultpeptide.com/drug-discovery/">https://www.difficultpeptide.com/drug-discovery/</a></p> <p>With a team of experienced experts, advanced research equipment, and proprietary methods, KS-V Peptides provides a one-stop service for your early peptide drug discovery and accelerates your drug development process.</p> <p>For CRO and drug discovery services, we are open to flexible business arrangements for our contract research and drug discovery services, which can include: Peptide Library Construction; PDC Drugs and Structure Confirmation.</p> <p>KS-V Peptides committed to providing reliable contract research services to our client's drug discovery processes. We can also provide you with quality peptide APIs based on the above services. Comprehensive drug development services are designed to reduce your cost and time and help you discover a list of high-quality peptide drugs.</p> <p>What is peptide medications?<br /> Peptide drug refers to a peptide having a specific therapeutic effect extracted by chemical synthesis genetic recombination or animal or plant and is a specific application of the peptide in the field of medicine. The biological activity of the peptide is extensive and important, and it can be widely applied to the endocrine system, the immune system, the digestive system, the cardiovascular system, the blood system, the musculoskeletal system, etc.</p> <p>As drugs, peptides have many advantages, such as wide indications, high safety, and significant efficacy. With the continuous development of biotechnology, more and more peptide medications have been developed and applied in clinical practice.</p> <p>For more information about peptide drugs list, please feel free to contact us!</p> <p>If you need any kinds of peptide service, please contact us, as one of the peptide synthesis suppliers, KS-V peptide is willing to offer you high quality products.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220824/10/peptide-library-construction-and-screening.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220824/10/peptide-library-construction-and-screening.jpg" alt="peptide-library-construction-and-screening.jpg" /></a></p> 2023-04-23T11:08:05+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/9HuLcu20bCU difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/9HuLcu20bCU#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/9HuLcu20bCU Custom Peptide Synthesis(2023年05月04日) <p><a href="https://www.difficultpeptide.com/custom-peptide-synthesis/">https://www.difficultpeptide.com/custom-peptide-synthesis/</a></p> <p>KS-V Peptide has always been committed to the research and development of advanced peptide synthesis technology. We have owned a number of peptide synthetics technologies and have been one of the top suppliers of custom peptide synthesis services in China today. Comprehensive quality control management and strict testing services ensure the high-quality delivery of each peptide. Our customers have covered world-renowned universities, research institutes, and biomedical companies.</p> <p>CUSTOM PEPTIDE SYNTHESIS SERVICES WE CAN PROVIDE</p> <p>Peptide display library/array synthesis long peptide synthesis</p> <p>Large-scale peptide synthesis</p> <p>D-type amino acid peptide synthesis service</p> <p>Recombinant peptide synthesis</p> <p>Peptide synthesis</p> <p>Glycopeptide Synthesis Service. Oligopeptide synthesis</p> <p>Bicyclic peptide synthesis service</p> <p>A variety of antigen peptides and dendrimers</p> <p>METHODS OF PEPTIDE SYNTHESIS<br /> We can provide peptide synthesis from mg to kg of high-quality compound synthesis, such as synthesis of APl intermediates, reference</p> <p>compounds, metabolites, and impurities expansion to non-GLP drug substances, as well as the development and synthesis of PROTAC drug molecules.</p> <p>Main Methods:</p> <p>1. Solid-phase peptide synthesis is used to prepare biologically active peptides, including long peptides, difficult peptides, and hydrophobic peptides.</p> <p>2. Biosynthesis provides different types of peptide modifications and customized peptides for diagnostic and therapeutic applications.</p> <p>SERVICE CONTENT OF OUR PEPTIDE SYNTHESIS<br /> Free peptide consultation and design<br /> Custom peptides according to your requirements such as ultra-long peptide.<br /> Peptide modification<br /> Mass spectrometry and HPLC chromatogram confirm purity and characteristics<br /> Provided as a lyophilized powder</p> <p>QUALITY CONTROL OF OUR CUSTOM PEPTIDE SYNTHESIS<br /> After peptide synthetics, each type of peptide synthesized is routinely analyzed by LC-MS, MALD-MSor HPLC to confirm the quality of the customized peptide.</p> <p>Mass spectrometry</p> <p>All peptides were analyzed by MALDl-MS to determine the molecular weight of the synthetic peptides.</p> <p>High-performance liquid chromatography</p> <p>MALDI is an excellent method to determine the presence of the desired product but it is not sufficient to determine purity. Therefore, all non-crude peptides must be analyzed by reversed-phase HPLC(RP-HPLC) to determine the purity. Other QC analyses can be performed, such as amino acid analysis, NMR, CE, and peptide content determination to confirm the quality of customized peptides.</p> <p>Other quality control (optional)</p> <p>Chromatography (HPLC,TLC,GC,IC)</p> <p>Chromatography combined with mass spectrometry (LC-MS/ESI)Metal analysis(AAS, ICP,ICP-MS)</p> <p>Titration (acid-base titration, Karl Fischer titration)</p> <p>Spectroscopy (Uv-Vis, IR, NMR)</p> <p>Elemental analysis</p> <p>Amino acid analysis</p> <p>Peptide sequencing</p> <p>WHY CHOOSE PEPTIDE SYNTHESIS SERVICE of KS-V PEPTIDE<br /> As a professional provider of peptides synthesis in China, KS-V Peptide aims to be the top reliable peptide synthesis company by offering excellent peptide synthesis services that featured by the following advantages:<br /> Consistent result: the success rate of delivering high-quality peptides stored in argon stabilizers> 99%;<br /> Not limited to short or long peptides, chemical or recombinant peptide technology;<br /> Lots of conjugation, modification, and labeling;<br /> Quality control: all peptides are analyzed by MS and HPLCFast turnaround;<br /> Free peptide design tool and competitive custom peptide synthesis price.</p> <p>As a peptide synthesis supplier, we provide peptide library services, peptide toxin, peptide service, peptide analysis services, custom large scale peptide synthesis, etc. Contact us to know custom peptide synthesis price or custom peptides synthesis applications.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" alt="peptides-we-can-provide.jpg" /></a></p> 2023-04-23T11:07:36+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ikymFD05q4C difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ikymFD05q4C#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ikymFD05q4C KS-V PEPTIDE CULTURE(2023年05月03日) <p><a href="https://www.difficultpeptide.com/company-culture.html">https://www.difficultpeptide.com/company-culture.html</a></p> <p>KS-V Peptide Culture<br /> Company Mission</p> <p>KSVP focuses on high-quality peptide products and services and is committed to promoting the research and development of innovative peptide and protein drugs.</p> <p>Company Vision</p> <p>Establish a standard system for the industrialization of the custom peptide synthesis service</p> <p>Promote the development of domestic innovative peptide drugs</p> <p>Build International Peptide Center in Hefei</p> <p>Values</p> <p>Safety first, quality first, efficient innovation, serving the society</p> <p>For more information about custom peptide manufacturing and epigenetic histone modification, please feel free to contact us!</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" alt="engineering-laboratory-of-peptide-drugs-company-culture.jpg" /></a></p> 2023-04-23T11:07:09+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6MxeGhiztv6 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6MxeGhiztv6#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6MxeGhiztv6 PEPTIDE SERVICES CENTER(2023年05月02日) <p><a href="https://www.difficultpeptide.com/820959-17-9_sp">https://www.difficultpeptide.com/820959-17-9_sp</a></p> <p>ABOUT KS-V PEPTIDE<br /> MORE ABOUT KS-V PEPTIDE</p> <p>ABOUT KS-V PEPTIDE<br /> Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>Besides, as one of the professional custom peptide synthesis companies in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.</p> <p>For more information about kurtoxin and epigenetics histone modification, please feel free to contact us!</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220818/09/custom-peptide_1660787778.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220818/09/custom-peptide_1660787778.jpg" alt="custom-peptide_1660787778.jpg" /></a></p> 2023-04-23T11:06:39+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VrogGA6fzr1 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VrogGA6fzr1#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VrogGA6fzr1 WHAT DOES UBIQUITIN DO?(2023年05月01日) <p><a href="https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html">https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html</a></p> <p>Ubiquitin is a highly conserved protein widely found in nuclear cells. It cooperates with ubiquitin activating enzyme (E1), ubiquitin conjugating enzyme (E2), and ubiquitin ligase (E3) to achieve ubiquitination and modification of specific proteins, and finally achieves the removal of aging, damaged and misfolded proteins, and is conducive to maintaining The normal physiological function of cells plays a very important role. In addition, some ubiquitination reactions can also achieve functional regulation independent of protein degradation.</p> <p>As a custom peptide company, we provide pre clinical trials, peptide toxin, peptide service, na+ channel blocker, multi ubiquitination, different types of ubiquitination, etc. Want to know ubiquitination function and what is the role of ubiquitin.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220905/15/long-peptide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220905/15/long-peptide.jpg" alt="long-peptide.jpg" /></a></p> 2023-04-23T11:05:54+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/MJuKzdb38w3 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/MJuKzdb38w3#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/MJuKzdb38w3 UB AMC(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/ub-amc/">https://www.difficultpeptide.com/products/ub-amc/</a></p> <p>Ubiquitin AMC is prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin.</p> <p>SPECIFICATION OF UB AMC<br /> CATU1010<br /> Product NameUb-AMC<br /> Purity≥95% by HPLC analysis<br /> AppearanceLyophilized powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> IntroductionUbiquitin-AMC is a fluorogenic substrate for a wide range of deubiquitinating enzymes (DUBs), including ubiquitin C-terminal hydrolases (UCHs) and ubiquitin-specific proteases (USPs). It is a particularly useful reagent for the study of deubiquitinating activity where detection sensitivity or continuous monitoring of activity is essential.</p> <p>APPLICATION OF UB AMC<br /> Can be used for the following applications:</p> <p>1. Substrate for deubiquitinylating enzyme activity assays.</p> <p>2. Identification/confirmation of enzyme deubiquitinylation activity.</p> <p>3. Investigation of deconjugating enzyme-substrate specificity in comparison with alternative UBL substrates.</p> <p>There are many peptide manufacturing companies in China, but we are one of the best choices for you.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-ub-amc.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-ub-amc.jpg" alt="application-of-ub-amc.jpg" /></a></p> 2023-03-03T16:25:22+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/H2Zr0kpJgt8 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/H2Zr0kpJgt8#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/H2Zr0kpJgt8 SYN AKE(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/syn-ake/">https://www.difficultpeptide.com/products/syn-ake/</a></p> <p>Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in venom.</p> <p>SPECIFICATION OF SYN AKE<br /> Purity(HPLC)≥99%<br /> Content≥75%<br /> Acetic Acid≤15%<br /> Moisture≤8%<br /> 20% below market price<br /> 10+kg per month<br /> Fast delivery</p> <p>APPLICATION OF SYN AKE<br /> Product NameSYN-AKE / Dipeptide Diaminobutyroyl Benzylamide<br /> CAS No823202-99-9Molecular FormulaC19H29N5O3(C2H4O2)2<br /> Sequencebeta-Ala-Pro-Dab-NHBzlMolecular Weight495.569g/mol<br /> Package1g, 10g, 100g, 500g, customizableAppearanceWhite Freeze-dried Powder<br /> ApplicationCosmetic raw materialsStorage2~8℃</p> <p>Efficacy and Mechanism of Action:</p> <p>Tripeptide-3 (sequence: beta-Ala-Pro-Dab-NHBn-2-Acetate), also known as dipeptide diaminobutyryl benzylamine diacetate or syn ake peptide, mimics the action of wagering-1, a peptide found in venom. V snake Tropidolaemus wagleri. Tripeptide-3 acts on the postsynaptic membrane and is a reversible antagonist of the acetylcholine receptor.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged difficult peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>If you want to know more details of modification of histones, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" alt="application-of-syn-ake.jpg" /></a></p> 2023-03-03T16:24:50+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/L3lGrgBlje9 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/L3lGrgBlje9#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/L3lGrgBlje9 SYN AKE(2023年03月) <p><a href="https://www.difficultpeptide.com/products/syn-ake/">https://www.difficultpeptide.com/products/syn-ake/</a></p> <p>Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in venom.</p> <p>SPECIFICATION OF SYN AKE<br /> Purity(HPLC)≥99%<br /> Content≥75%<br /> Acetic Acid≤15%<br /> Moisture≤8%<br /> 20% below market price<br /> 10+kg per month<br /> Fast delivery</p> <p>APPLICATION OF SYN AKE<br /> Product NameSYN-AKE / Dipeptide Diaminobutyroyl Benzylamide<br /> CAS No823202-99-9Molecular FormulaC19H29N5O3(C2H4O2)2<br /> Sequencebeta-Ala-Pro-Dab-NHBzlMolecular Weight495.569g/mol<br /> Package1g, 10g, 100g, 500g, customizableAppearanceWhite Freeze-dried Powder<br /> ApplicationCosmetic raw materialsStorage2~8℃</p> <p>Efficacy and Mechanism of Action:</p> <p>Tripeptide-3 (sequence: beta-Ala-Pro-Dab-NHBn-2-Acetate), also known as dipeptide diaminobutyryl benzylamine diacetate or syn ake peptide, mimics the action of wagering-1, a peptide found in venom. V snake Tropidolaemus wagleri. Tripeptide-3 acts on the postsynaptic membrane and is a reversible antagonist of the acetylcholine receptor.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged difficult peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>If you want to know more details of modification of histones, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" alt="application-of-syn-ake.jpg" /></a></p> 2023-03-03T16:23:20+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/FsvD3B8wcOL difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/FsvD3B8wcOL#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/FsvD3B8wcOL SHK TOXIN(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/shk-toxin/">https://www.difficultpeptide.com/products/shk-toxin/</a></p> <p>Various KV K+ channels. Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.</p> <p>SPECIFICATION OF SHK TOXIN<br /> CATK1010-V<br /> CAS NO.172450-46-3<br /> Product NameShK Toxin<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4055 Da<br /> Molecular formulaC169H274N54O48S7<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceRSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32)</p> <p>APPLICATION OF SHK TOXIN<br /> ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and custom peptide library suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biological technology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-shk-toxin.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-shk-toxin.jpg" alt="application-of-shk-toxin.jpg" /></a></p> 2023-03-03T16:22:51+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/isIp10qbHGR difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/isIp10qbHGR#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/isIp10qbHGR SEMAGLUTIDE AND IMPURITY(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/semaglutide-and-impurity/">https://www.difficultpeptide.com/products/semaglutide-and-impurity/</a></p> <p>Semaglutide Peptide for Sale</p> <p>"Natural semaglutide is a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which is used in combination with diet and exercise in the therapy of type 2 diabetes, either alone or in combination with other antidiabetic agents."</p> <p>SPECIFICATION OF SEMAGLUTIDE AND IMPURITY<br /> CAS NO.910463-68-2<br /> Product NameSemaglutide<br /> Purity(HPLC)98%<br /> AppearanceWhite powder<br /> Molecular weight4114 g/mol<br /> Molecular formulaC187H291N45O59</p> <p>APPLICATION OF SEMAGLUTIDE AND IMPURITY<br /> Indication:<br /> Semaglutide is a recombinant DNA-produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which is used in combination with diet and exercise in the therapy of type 2 diabetes, either alone or in combination with other antidiabetic agents.</p> <p>Efficacy and mechanism of action<br /> long-acting human glucagon-like peptide-1 (GLP-1) analog developed by Novo Nordisk was subcutaneously injected once a week. It was approved by the FDA for marketing in December 2017 under the trade name Ozempic.</p> <p>Note: All products of Hefei KS-V Peptide CDMO are for scientific research only, not for clinical trials.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and custom peptide synthesis china suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-semaglutide-and-impurity.png" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-semaglutide-and-impurity.png" alt="application-of-semaglutide-and-impurity.png" /></a></p> 2023-03-03T16:22:25+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zkBGtorgq02 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zkBGtorgq02#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zkBGtorgq02 PSALMOTOXIN 1(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/psalmotoxin-1/">https://www.difficultpeptide.com/products/psalmotoxin-1/</a></p> <p>ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2</p> <p>SPECIFICATION OF PSALMOTOXIN 1<br /> CATO1120-V<br /> CAS NO./<br /> Product NamePsalmotoxin 1<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4689.5 Da<br /> Molecular formulaC200H312N62O57S6<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceEDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33)</p> <p>APPLICATION OF PSALMOTOXIN 1<br /> Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide synthesis china that inhibits cation currents mediated by acid-sensing ion channels (ASIC).</p> <p>More details of toxicological analysis, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-psalmotoxin-1.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-psalmotoxin-1.jpg" alt="application-of-psalmotoxin-1.jpg" /></a></p> 2023-03-03T16:21:06+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/aGybIZd1Ll2 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/aGybIZd1Ll2#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/aGybIZd1Ll2 PROTOXIN II(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/protoxin-ii/">https://www.difficultpeptide.com/products/protoxin-ii/</a></p> <p>NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.</p> <p>SPECIFICATION OF PROTOXIN II<br /> CATN1030-V<br /> CAS NO.165168-50-3<br /> Product NameProtoxin II<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4054.85 Da<br /> Molecular formulaC169H274N54O48S7<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceRSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32)</p> <p>APPLICATION OF PROTOXIN II<br /> Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.</p> <p>As one of peptide synthesis companies, we can offer kinds of related products for sale, anything you need, please leave us a message.</p> <p>More kinds of peptide service, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-protoxin-ii.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-protoxin-ii.jpg" alt="application-of-protoxin-ii.jpg" /></a></p> 2023-03-03T16:20:40+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/294hGZbYHu1 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/294hGZbYHu1#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/294hGZbYHu1 PLTX II(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/pltx-ii/">https://www.difficultpeptide.com/products/pltx-ii/</a></p> <p>SNX482<br /> Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective exocytosis inhibitor. Shows insecticidal effects in vivo.</p> <p>SPECIFICATION OF PLTX II<br /> CATC1100-V<br /> CAS NO./<br /> Product NamePLTX-II (PLTX-II, presynaptic voltage-gated Ca2+ channel blocker)<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight5108.73<br /> Molecular formulaC208H313N61O70S10<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceADCSATGDTCDHTKKCCDDCYTCRCGTPWGANCRCDYYKARCDT (Modifications: C-terminal amide; Thr-44 = O-palmitoyl; Disulfide bonds: 3-17, 10-23, 16-35, 20-42, 25-33)</p> <p>APPLICATION OF PLTX II<br /> PLTX II, a presynaptic calcium channel blocker in Drosophila isolated from the plectrums spider venom, is a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus</p> <p>If you want to know more kinds of custom polypeptides, please visit our website.</p> <p>More applications of peptides synthesis, please visit contact us.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-pltx-ii.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-pltx-ii.jpg" alt="application-of-pltx-ii.jpg" /></a></p> 2023-03-03T16:20:14+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VqucRUs5WxB difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VqucRUs5WxB#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VqucRUs5WxB PLECANATIDE(2023年03月03日) <p><a href="https://www.difficultpeptide.com/products/plecanatide/">https://www.difficultpeptide.com/products/plecanatide/</a></p> <p>Polypeptides is a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation and irritable bowel syndrome.</p> <p>SPECIFICATION OF PLECANATIDE<br /> CAS NO.467426-54-6<br /> Product NamePlecanatide<br /> Purity(HPLC)98%<br /> AppearanceWhite powder<br /> Molecular weight1681.9 g/mol<br /> Molecular formulaC65H104N18O26S4<br /> Storage-20℃</p> <p>APPLICATION OF PLECANATIDE<br /> Indication:<br /> Plecanatide tablets is a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation and irritable bowel syndrome.</p> <p>Note: All products of Hefei KS V Peptide are for scientific research only, not for clinical trials.</p> <p>As a peptide company, we can offer kinds of related products for sale, if you have needs, please contact us.<br /> <a href="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-plecanatide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-plecanatide.jpg" alt="application-of-plecanatide.jpg" /></a></p> 2023-03-03T16:19:20+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/5aGU6X4duh5 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/5aGU6X4duh5#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/5aGU6X4duh5 Kaliotoxin(2023年01月19日) <p><a href="https://www.difficultpeptide.com/products/kaliotoxin/">https://www.difficultpeptide.com/products/kaliotoxin/</a></p> <p>SPECIFICATION OF KALIOTOXIN</p> <p>CATK1070-V<br /> CAS NO.145199-73-1<br /> Product NameKaliotoxin<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4149.89 Da<br /> Molecular formulaC171H283N55O49S6<br /> SourceSynthetic route peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceGVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35)</p> <p>APPLICATION OF KALIOTOXIN<br /> Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide custom synthesis china suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-kaliotoxin.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-kaliotoxin.jpg" alt="application-of-kaliotoxin.jpg" /></a></p> 2023-01-05T12:05:03+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/EAx7k3yPVNe difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/EAx7k3yPVNe#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/EAx7k3yPVNe Iberiotoxin(2023年01月17日) <p><a href="https://www.difficultpeptide.com/products/iberiotoxin/">https://www.difficultpeptide.com/products/iberiotoxin/</a></p> <p>IBERIOTOXIN<br /> KCa1.1 K+ channels, Iberiotoxin is a potent selective blocker of the high conductance Ca2+-activated K+ channels (maxi-K).</p> <p>SPECIFICATION OF IBERIOTOXIN</p> <p>CATK1060-V<br /> CAS NO.129203-60-7<br /> Product NameIberiotoxin<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4230.9 Da<br /> Molecular formulaC179H276N50O56S7<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid)</p> <p>APPLICATION OF IBERIOTOXIN<br /> Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.</p> <p>Hefei KS-V peptide biological technology Co.,Ltd. is a high-tech enterprise focusing on Peptide CDMO drug discovery and innovative technology services. The founding team is from Tsinghua University and University of Science and Technology of China, and the management team has rich experience in innovative drug R&D and technical services. With peptide as the core, the company has built a core peptide seed bank, including DNA coding and combinatorial chemical peptide library, phage display bicyclic peptide library, etc. , in vitro functional screening (especially membrane protein targets), structure analysis, pharmacological efficacy, pharmacokinetics and other core technology platforms, can provide comprehensive services for pharmaceutical companies, biotechnology companies, and scientific research units.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-iberiotoxin.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-iberiotoxin.jpg" alt="application-of-iberiotoxin.jpg" /></a></p> 2023-01-05T12:04:36+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lWaic9IhRKf difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lWaic9IhRKf#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lWaic9IhRKf Huwentoxin Iv(2023年01月15日) <p><a href="https://www.difficultpeptide.com/products/huwentoxin-iv/">https://www.difficultpeptide.com/products/huwentoxin-iv/</a></p> <p>HUWENTOXIN IV<br /> TTX-sensitive Na+ channels, Huwentoxin-IV specifically inhibits the neuronal tetrodotoxin-sensitive (TTX-S) voltage-gated Na+ channel (IC50 = 30 nM) in adult rat dorsal root ganglion neurons, while having no significant effect on the tetrodotoxin-resistant (TTX-R) voltage-gated Na+ channel1-3.</p> <p>SPECIFICATION OF HUWENTOXIN IV</p> <p>CATN1020-V<br /> CAS NO.526224-73-7<br /> Product Namehuwentoxin IV<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4107.20 Da<br /> Molecular formulaC174H277N51O52S6<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI (Disulfide bonds: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31)</p> <p>APPLICATION OF HUWENTOXIN IV<br /> Huwentoxin-IV, a component of tarantula venom, potently blocks sodium channels and is an attractive scaffold for engineering a Nav1.7-selective molecule</p> <p>As the best peptide supplier, we will do our best to provide more types of related products for sale, anything you need, please contact us.</p> <p>If you want to know more details of epigenetic histone modification, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-huwentoxin-iv.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-huwentoxin-iv.jpg" alt="application-of-huwentoxin-iv.jpg" /></a></p> 2023-01-05T12:04:07+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/XQEwapIWire difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/XQEwapIWire#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/XQEwapIWire H4K8ac(2023年01月13日) <p><a href="https://www.difficultpeptide.com/products/h4k8ac/">https://www.difficultpeptide.com/products/h4k8ac/</a></p> <p>H4K8AC<br /> Synthesized histone H4 peptide corresponding to residues within 1-102 of human histone H4 with acetylation K8 modification.</p> <p>SPECIFICATION OF H4K8AC</p> <p>CATH4201<br /> Product NameHistone H4-K8ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGK(ac)GL GKGGAKRHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K8AC<br /> H4K8ac, representing an epigenetic modification to the DNA packaging protein histone H4, is a mark indicating the acetylation at the 8th lysine residue of the histone H4 protein. It has been implicated in the prevalence of malaria.</p> <p>As a chinese peptide company, we will do our best to meet all the needs of customers.</p> <p>If you want to know more about chemical structure identification, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k8ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k8ac.jpg" alt="application-of-h4k8ac.jpg" /></a></p> 2023-01-05T12:03:40+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/efLXTEt6ype difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/efLXTEt6ype#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/efLXTEt6ype H4K20ac(2023年01月11日) <p><a href="https://www.difficultpeptide.com/products/h4k20ac/">https://www.difficultpeptide.com/products/h4k20ac/</a></p> <p>H4K20AC<br /> Synthesized histone H4 peptide corresponding to residues within 1-102 of human histone H4 with acetylation K20 modification.</p> <p>SPECIFICATION OF H4K20AC</p> <p>CATH4204<br /> Product NameHistone H4-K20ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GKGGAKRHRK(ac) VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K20AC<br /> Modification of histones are associated with distinct transcription states and serve as heritable epigenetic markers for chromatin structure and function. H4K20ac is associated with gene repression in human cells. Unlike H3K9me3, a constitutive heterochromatin mark, H4K20ac was less associated with TSSs of completely silenced genes (those with no mRNA expression), suggesting that H4K20ac may play a role in repressing transcribed genes rather than in assisting with heterochromatin formation to induce a fully silent state, possibly preventing methylation on the same residue.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k20ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k20ac.jpg" alt="application-of-h4k20ac.jpg" /></a></p> 2023-01-05T12:03:13+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/Q0Yutv0dAi3 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/Q0Yutv0dAi3#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/Q0Yutv0dAi3 H4K16ac(2023年01月09日) <p><a href="https://www.difficultpeptide.com/products/h4k16ac/">https://www.difficultpeptide.com/products/h4k16ac/</a></p> <p>SPECIFICATION OF H4K16AC</p> <p>CATH4203<br /> Product NameHistone H4-K16ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GKGGAK(ac)RHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K16AC<br /> H4K16ac antibody is an epigenetic modification to the DNA packaging protein Histone H4. It is a mark that indicates the acetylation at the 16th lysine residue of the histone H4 protein. H4K16ac is unusual in that it has both transcriptional activation AND repression activities. The loss of H4K20me3 along with a reduction of H4K16ac is a strong indicator of cancer.</p> <p>Acetylation of histone H4 on lysine 16 (H4K16ac) is especially important for chromatin structure and function in a variety of eukaryotes and is catalyzed by specific histone lysine acetyltransferases (HATs). H4K16 is particularly interesting because this is the only acetylatable site of the H4 N-terminal tail, and can influence the formation of a compact higher-order chromatin structure. Hypoacetylation of H4K16 appears to cause delayed recruitment of DNA repair proteins to sites of DNA damage in a mouse model of the premature aging syndrome Hutchinson Gilford progeria. H4K16ac also has roles in transcriptional activation and the maintenance of euchromatin.</p> <p>As one of the best peptide synthesis companies in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/17/application-of-h4k16ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/17/application-of-h4k16ac.jpg" alt="application-of-h4k16ac.jpg" /></a></p> 2023-01-05T12:02:46+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/4SwhVtapjTO difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/4SwhVtapjTO#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/4SwhVtapjTO H4K12ac(2023年01月07日) <p><a href="https://www.difficultpeptide.com/products/h4k12ac/">https://www.difficultpeptide.com/products/h4k12ac/</a></p> <p>SPECIFICATION OF H4K12AC</p> <p>CATH4202<br /> Product NameHistone H4-K12ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GK(ac)GGAKRHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K12AC<br /> H4K12ac is an epigenetic modification to the DNA packaging protein histone H4. It is a mark that indicates the acetylation at the 12th lysine residue of the histone H4 protein. H4K12ac is involved in learning and memory. It is possible that restoring this modification could reduce age-related decline in memory.</p> <p>As one of reputable peptide companies, we can offer kinds of peptides synthesis for sale, anything you need, please leave us a message.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k12ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k12ac.jpg" alt="application-of-h4k12ac.jpg" /></a></p> 2023-01-05T12:02:20+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/c6Mn3PZJ06c difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/c6Mn3PZJ06c#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/c6Mn3PZJ06c Common Histone H4(2023年01月05日) <p><a href="https://www.difficultpeptide.com/products/h4/">https://www.difficultpeptide.com/products/h4/</a></p> <p>SPECIFICATION OF HISTONE H4</p> <p>CATH4100<br /> Product NameHistone H4<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GKGGAKRHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF HISTONE H4<br /> Histone H4 is one of the five main human histone h4 protein involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H4 is involved with the structure of the nucleosome of the 'beads on a string' organization. Histone H4 is an important protein in the structure and function of chromatin, where its sequence variants and variable modification states are thought to play a role in the dynamic and long-term regulation of genes.</p> <p>Histone H4 is a 102 to 135 amino acid protein which shares a structural motif, known as the histone fold, formed from three a-helices connected by two loops. Histone proteins H3 and H4 bind to form an H3-H4 dimer, two of these H3-H4 dimers combine to form a tetramer. This tetramer further combines with two H2a-H2b dimers to form the compact Histone octamer core.</p> <p>Histone methylation occurs on arginine, lysine and histidine amino acids residues. Mono-, di- or tri-methylation has been discovered on histone H2A, H3 and H4. Histone methylation has been associated with various cellular functions such as transcription, DNA replication, and DNA damage response including repair, heterochromatin formation, and somatic cell reprogramming. Also methylation of histone H4 by PRMT1 was sufficient to permit subsequent acetylation on the N-terminal tail. However, acetylation of H4 inhibits its methylation by PRMT1, such as H4K20me2.</p> <p>Acetylation of histones is thought to relax condensed heterochromatin as the negative charge of acetyl groups can repel the DNA phosphate backbone charges, thus reducing the histone binding affinity for DNA. We can provide H4K5ac, H4K8ac, H4K12ac, H4K16ac, H4K20ac.</p> <p>If you want to know more details of histone h4 peptide, please visit our website.</p> <p>As one of custom peptide synthesis companies, we can offer kinds of related products for sale, anything you need, please leave us a message.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/15/application-of-histone-h4.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/15/application-of-histone-h4.jpg" alt="application-of-histone-h4.jpg" /></a></p> 2023-01-05T12:01:55+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/fcwFNgU7AiW difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/fcwFNgU7AiW#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/fcwFNgU7AiW INTRODUCTION TO SBDD(2022年) <p><a href="https://www.difficultpeptide.com/introduction-to-sbdd.html">https://www.difficultpeptide.com/introduction-to-sbdd.html</a></p> <p>Ⅰ.What is SBDD?</p> <p>Structure based drug design (SBDD) is a drug design method based on molecular recognition from the three-dimensional structure of ligands and targets. According to drugs and their targets, such as receptors, enzymes, ion channels, nucleic acids, antigens and viruses, we can find and design reasonable drug molecules.</p> <p>Generally, the steps of SBDD include protein structure preparation, binding site recognition, ligand library preparation, docking and scoring function.</p> <p>Target is the prerequisite of drug design. The selection of reasonable drug target directly determines the success or failure of drug development. The three-dimensional structure of the target can often be obtained by computer model methods such as X-ray crystallography, multi-dimensional nuclear magnetic resonance or homologous protein structure prediction. Secondly, the interaction model between drug and receptor is measured by experimental means or studied by computational method, and the rational drug design is carried out on this basis; In addition to considering the structural characteristics of drugs and receptors, it is also necessary to consider the influence of factors such as drug solubility, toxicity and metabolic process. Reasonable drug design usually requires 10-15 cycles to find the "most suitable" drug molecules.</p> <p>Ⅱ. Advantages and disadvantages of SBDD Technology Platform</p> <p>1.Advantages: low screening cost. Candidate drugs can be obtained from a small number of compounds; It can significantly improve the hit rate of drug discovery; It can directly predict the drug receptor binding energy.<br /> 2.<br /> 3.Deficiency: This design requires a complete and clear three-dimensional structure of the target; it only considers the binding strength of the drug and the receptor, and cannot predict the efficacy of the drug; the speed is slow.</p> <p>As one of the most professional peptide manufacturing companies, we provide custom peptide synthesis china, g2s services, histone h3, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210628/11/engineering-laboratory-of-peptide-drugs6.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210628/11/engineering-laboratory-of-peptide-drugs6.jpg" alt="engineering-laboratory-of-peptide-drugs6.jpg" /></a></p> 2022-06-09T10:52:58+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zRHbWRl1L7L difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zRHbWRl1L7L#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zRHbWRl1L7L GENE TO STRUCTURE(2022年) <p><a href="https://www.difficultpeptide.com/gene-to-structure/">https://www.difficultpeptide.com/gene-to-structure/</a></p> <p>As a professional peptide company in China, we can provide innovative drugs from gene to protein, from gene to structure, from structure to lead compound to new drug preclinical candidate drug and other services, and efficiently promote the discovery of innovative drug candidates.</p> <p>OUR ADVANTAGES IN GENE TO STRUCTURE<br /> Our Advantages in Gene to Structure<br /> We have several methods which are used to determine the structure of a biomacromolecule, including Nuclear Magnetic Resonance (NMR) spectroscopy and Cryogenic Electron Microscopy (cryo-EM).</p> <p>We have the most complete and state-of-the-art platform and professional knowledge cluster.</p> <p>After finishing the study, KS-V peptide company will provide you with the confidential structural determination report:</p> <p>–A report of the process of the different phase</p> <p>–Structure confirmation</p> <p>As one of the most professional peptide pharmaceutical companies, we provide custom peptide synthesis china, g2s services, epigenetic histone modification, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210719/14/peptides-we-can-provide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210719/14/peptides-we-can-provide.jpg" alt="peptides-we-can-provide.jpg" /></a></p> 2022-06-09T10:52:36+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lAOixEu9768 difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lAOixEu9768#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lAOixEu9768 PEPTIDE DRUG DISCOVERY(2022年) <p><a href="https://www.difficultpeptide.com/drug-discovery/">https://www.difficultpeptide.com/drug-discovery/</a></p> <p>With a team of experienced experts, advanced research equipment, and proprietary methods, KS-V Peptides provides a one-stop service for your early peptide drug discovery and accelerates your drug development process.</p> <p>For CRO and drug discovery services, we are open to flexible business arrangements for our contract research and drug discovery services, which can include: Peptide Library Construction; PDC Drugs and Structure Confirmation.</p> <p>KS-V Peptides committed to providing reliable contract research services to our client's drug discovery processes. We can also provide you with quality peptide APIs based on the above services. Comprehensive drug development services are designed to reduce your cost and time and help you discover a list of peptide drugs .</p> <p>What is Peptide Drug?<br /> Peptide drug refers to a peptide having a specific therapeutic effect extracted by chemical synthesis genetic recombination or animal or plant and is a specific application of the peptide in the field of medicine. The biological activity of the peptide is extensive and important, and it can be widely applied to the endocrine system, the immune system, the digestive system, the cardiovascular system, the blood system, the musculoskeletal system, etc.</p> <p>As drugs, peptides have many advantages, such as wide indications, high safety, and significant efficacy. With the continuous development of biotechnology, more and more peptide medications have been developed and applied in clinical practice.</p> <p>As one of the most professional peptide synthesis suppliers, we provide custom peptide synthesis china, custom large scale peptide synthesis, epigenetics histone modification, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210705/09/peptide-library-construction.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210705/09/peptide-library-construction.jpg" alt="peptide-library-construction.jpg" /></a><br /> <a href="https://www.difficultpeptide.com/uploads/image/20210802/16/pdc-drugs.png" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210802/16/pdc-drugs.png" alt="pdc-drugs.png" /></a><br /> <a href="https://www.difficultpeptide.com/uploads/image/20210802/16/structure-confirmation.png" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210802/16/structure-confirmation.png" alt="structure-confirmation.png" /></a></p> 2022-06-09T10:52:15+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6RxkfFSuVus difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6RxkfFSuVus#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6RxkfFSuVus CUSTOM PEPTIDE SYNTHESIS(2022年) <p><a href="https://www.difficultpeptide.com/custom-peptide-synthesis/">https://www.difficultpeptide.com/custom-peptide-synthesis/</a></p> <p>KS-V Peptide has always been committed to the research and development of advanced peptide synthesis technology. We have owned a number of peptide synthesis technologies and have been one of the top suppliers of custom peptide synthesis services in China today. Comprehensive quality control management and strict testing services ensure the high-quality delivery of each peptide. Our customers have covered world-renowned universities, research institutes, and biomedical companies.</p> <p>CUSTOM PEPTIDE SYNTHESIS SERVICES WE CAN PROVIDE</p> <p>Peptide display library/array synthesis long peptide synthesis</p> <p>Large-scale peptide synthesis</p> <p>D-type amino acid peptide synthesis service</p> <p>Recombinant peptide synthesis</p> <p>Peptide synthesis</p> <p>Glycopeptide Synthesis Service. Oligopeptide synthesis</p> <p>Bicyclic peptide synthesis service</p> <p>A variety of antigen peptides and dendrimers</p> <p>METHODS OF PEPTIDE SYNTHESIS<br /> We can provide peptide synthesis from mg to kg of high-quality compound synthesis, such as synthesis of APl intermediates, reference</p> <p>compounds, metabolites, and impurities expansion to non-GLP drug substances, as well as the development and synthesis of PROTAC drug molecules.</p> <p>Main Methods:</p> <p>1. Solid-phase peptide synthesis is used to prepare biologically active peptides, including long peptides, difficult peptides, and hydrophobic peptides.</p> <p>2. Biosynthesis provides different types of peptide modifications and customized peptides for diagnostic and therapeutic applications.</p> <p>SERVICE CONTENT OF OUR PEPTIDE SYNTHESIS<br /> Free peptide consultation and design</p> <p>Custom peptides according to your requirements such as ultra-long peptide.</p> <p>Peptide modification</p> <p>Mass spectrometry and HPLC chromatogram confirm purity and characteristics</p> <p>Provided as a lyophilized powder</p> <p>QUALITY CONTROL OF OUR CUSTOM PEPTIDE SYNTHESIS<br /> After peptide synthetics, each type of peptide synthesized is routinely analyzed by LC-MS, MALD-MSor HPLC to confirm the quality of the customized peptide.</p> <p>Mass spectrometry</p> <p>All peptides were analyzed by MALDl-MS to determine the molecular weight of the synthetic peptides.</p> <p>High-performance liquid chromatography</p> <p>MALDI is an excellent method to determine the presence of the desired product but it is not sufficient to determine purity. Therefore, all non-crude peptides must be analyzed by reversed-phase HPLC(RP-HPLC) to determine the purity. Other QC analyses can be performed, such as amino acid analysis, NMR, CE, and peptide content determination to confirm the quality of customized peptides.</p> <p>WHY CHOOSE PEPTIDE SYNTHESIS SERVICE of KS-V PEPTIDE<br /> As a professional provider of peptide synthesis in China, KS-V Peptide aims to be the top reliable peptide synthesis company by offering excellent peptide synthesis services that featured by the following advantages:</p> <p>Consistent result: the success rate of delivering high-quality peptides stored in argon stabilizers> 99%;</p> <p>Not limited to short or long peptides, chemical or recombinant peptide technology;</p> <p>Lots of conjugation, modification, and labeling;</p> <p>Quality control: all peptides are analyzed by MS and HPLCFast turnaround;</p> <p>Free peptide design tool and competitive custom peptide synthesis price.</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional peptide synthesis supplier, we provide custom peptide synthesis china, custom large scale peptide synthesis, peptide analysis services, peptide modification services, peptides synthesis, etc. Contact us to know custom peptides synthesis applications or more.<br /> <a href="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" alt="peptides-we-can-provide.jpg" /></a></p> 2022-06-09T10:51:52+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ETLQoulE4Sz difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ETLQoulE4Sz#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ETLQoulE4Sz KSVP CULTURE(2022年) <p><a href="https://www.difficultpeptide.com/company-culture.html">https://www.difficultpeptide.com/company-culture.html</a></p> <p>KSVP CULTURE</p> <p>Company Mission</p> <p>KSV Peptide focuses on high-quality peptide products and services and is committed to promoting the research and development of innovative peptide and protein drugs.</p> <p>Company Vision</p> <p>Establish a standard system for the industrialization of the custom peptide synthesis service</p> <p>Promote the development of domestic innovative peptide drugs</p> <p>Build International Peptide Center in Hefei</p> <p>Values</p> <p>Safety first, quality first, efficient innovation, serving the society</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional custom peptide company, we provide custom peptide synthesis china, peptide service, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" alt="engineering-laboratory-of-peptide-drugs-company-culture.jpg" /></a></p> 2022-06-09T10:51:27+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ocOnVIz1L7Y difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ocOnVIz1L7Y#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ocOnVIz1L7Y ABOUT KS-V PEPTIDE(2022年) <p><a href="https://www.difficultpeptide.com/">https://www.difficultpeptide.com/</a></p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>Besides, as one of the professional custom peptide synthesis companies in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional peptide synthesis supplier, we provide custom peptide synthesis china, na+ channel blocker, peptide service, kurtoxin, histone h4, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210622/14/about-ks-v-peptide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210622/14/about-ks-v-peptide.jpg" alt="about-ks-v-peptide.jpg" /></a></p> 2022-06-09T10:51:01+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/hvzRINkS8sV difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/hvzRINkS8sV#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/hvzRINkS8sV WHAT DOES UBIQUITIN DO?(2022年) <p><a href="https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html">https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html</a></p> <p>Ubiquitin is a highly conserved protein widely found in nuclear cells. It cooperates with ubiquitin activating enzyme (E1), multi ubiquitination conjugating enzyme (E2), and ubiquitin ligase (E3) to achieve ubiquitination and modification of specific proteins, and finally achieves the removal of aging, damaged and misfolded proteins, and is conducive to maintaining The normal physiological function of cells plays a very important role. In addition, some ubiquitination reactions can also achieve functional regulation independent of protein degradation.</p> <p>Want to know what is the role of ubiquitin and types of ubiquitination, please contact us.</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional peptide synthesis supplier, we provide peptide synthesis china, na+ channel blocker, peptide service, semaglutide for sale, etc. Contact us to know ubiquitination function or more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h3k36me3.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h3k36me3.jpg" alt="application-of-h3k36me3.jpg" /></a></p> 2022-06-09T10:50:37+0900 http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/RSYgaEoYfPQ difficultpeptide http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/RSYgaEoYfPQ#comments http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/RSYgaEoYfPQ
This XML file does not appear to have any style information associated with it. The document tree is shown below.
<rss version="2.0">
<channel>
<title>Hefei KS-V Peptide Biological Technology Co., Ltd.</title>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd.</link>
<description>Hefei KS-V Peptide Biological Technology Co., Ltd. https://www.difficultpeptide.com/</description>
<language>ja-JP</language>
<item>
<title>INTRODUCTION TO SBDD(2023年05月07日)</title>
<description><p><a href="https://www.difficultpeptide.com/introduction-to-sbdd.html">https://www.difficultpeptide.com/introduction-to-sbdd.html</a></p> <p>Ⅰ.What is SBDD?</p> <p>Structure based drug design (SBDD) is a drug design method based on molecular recognition from the three-dimensional structure of ligands and targets. According to drugs and their targets, such as receptors, enzymes, ion channels, nucleic acids, antigens and viruses, we can find and design reasonable drug molecules.</p> <p>Generally, the steps of SBDD include protein structure preparation, binding site recognition, ligand library preparation, docking and scoring function.</p> <p>Target is the prerequisite of drug design. The selection of reasonable drug target directly determines the success or failure of drug development. The three-dimensional structure of the target can often be obtained by computer model methods such as X-ray crystallography, multi-dimensional nuclear magnetic resonance or homologous protein structure prediction. Secondly, the interaction model between drug and receptor is measured by experimental means or studied by computational method, and the rational drug design is carried out on this basis; In addition to considering the structural characteristics of drugs and receptors, it is also necessary to consider the influence of factors such as drug solubility, toxicity and metabolic process. Reasonable drug design usually requires 10-15 cycles to find the "most suitable" drug molecules.</p> <p>Ⅱ. Advantages and disadvantages of SBDD Technology Platform</p> <p>1. Advantages: low screening cost. Candidate drugs can be obtained from a small number of compounds; It can significantly improve the hit rate of drug discovery; It can directly predict the drug receptor binding energy.</p> <p>2. Deficiency: This design requires a complete and clear three-dimensional structure of the target; it only considers the binding strength of the drug and the receptor, and cannot predict the efficacy of the drug; the speed is slow.</p> <p>If you need any kinds of peptides synthesis, please contact us, as the peptide pharmaceutical companies, KS-V peptide is willing to offer you high quality products.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220824/11/structural-biology.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220824/11/structural-biology.jpg" alt="structural-biology.jpg" /></a></p> </description>
<pubDate>2023-04-23T11:09:02+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/wucQe6cX3gR</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/wucQe6cX3gR#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/wucQe6cX3gR</guid>
</item>
<item>
<title>Gene to Structure(2023年05月06日)</title>
<description><p><a href="https://www.difficultpeptide.com/gene-to-structure/">https://www.difficultpeptide.com/gene-to-structure/</a></p> <p>As a professional peptide company in China, we can provide innovative drugs from gene to protein, from gene to structure, from structure to lead compound to new drug preclinical candidate drug and other services, and efficiently promote the discovery of innovative drug candidates.</p> <p>OUR CAPABILITIES IN GENE TO STRUCTURE<br /> ● Construct design with all commercially available vectors<br /> ● Multiple tags, inserts, mutations, deletes, and multi-parallel construct design<br /> ● High capacity protein expression in E Coli, Insect cells, and mammalian cells<br /> ● Automatic protein purification by AKTA.<br /> ● Double stand DNA purification<br /> ● Post-treatment of protein for crystallization: Protein refolding, dephosphorylation, and deglycosylation<br /> ● 13C, 2H, and 15N Labeled proteins for NMR<br /> ● Membrane protein purification from over 70 GPCR stable cell lines, 50 human gene targets.<br /> ● Endotoxin-free protein purification (Final endotoxin as low as 0.1EU/mg)</p> <p>●Off-the-Shelf protein production service</p> <p>OUR ADVANTAGES IN GENE TO STRUCTURE<br /> Our Advantages in Gene to Structure<br /> We have several methods which are used to determine the structure of a biomacromolecule, including Nuclear Magnetic Resonance (NMR) spectroscopy and Cryogenic Electron Microscopy (cryo-EM).</p> <p>We have the most complete and state-of-the-art platform and professional knowledge cluster.</p> <p>After finishing the study, KS-V peptide company will provide you with the confidential structural determination report:</p> <p>–A report of the process of the different phase</p> <p>–Structure confirmation</p> <p>For more information about g2s services and custom synthesis china, please feel free to contact us!</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210719/14/service-content-of-our-peptide-synthesis.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210719/14/service-content-of-our-peptide-synthesis.jpg" alt="service-content-of-our-peptide-synthesis.jpg" /></a></p> </description>
<pubDate>2023-04-23T11:08:35+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/dm6nEBPl3ju</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/dm6nEBPl3ju#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/dm6nEBPl3ju</guid>
</item>
<item>
<title>Drug Discovery(2023年05月05日)</title>
<description><p><a href="https://www.difficultpeptide.com/drug-discovery/">https://www.difficultpeptide.com/drug-discovery/</a></p> <p>With a team of experienced experts, advanced research equipment, and proprietary methods, KS-V Peptides provides a one-stop service for your early peptide drug discovery and accelerates your drug development process.</p> <p>For CRO and drug discovery services, we are open to flexible business arrangements for our contract research and drug discovery services, which can include: Peptide Library Construction; PDC Drugs and Structure Confirmation.</p> <p>KS-V Peptides committed to providing reliable contract research services to our client's drug discovery processes. We can also provide you with quality peptide APIs based on the above services. Comprehensive drug development services are designed to reduce your cost and time and help you discover a list of high-quality peptide drugs.</p> <p>What is peptide medications?<br /> Peptide drug refers to a peptide having a specific therapeutic effect extracted by chemical synthesis genetic recombination or animal or plant and is a specific application of the peptide in the field of medicine. The biological activity of the peptide is extensive and important, and it can be widely applied to the endocrine system, the immune system, the digestive system, the cardiovascular system, the blood system, the musculoskeletal system, etc.</p> <p>As drugs, peptides have many advantages, such as wide indications, high safety, and significant efficacy. With the continuous development of biotechnology, more and more peptide medications have been developed and applied in clinical practice.</p> <p>For more information about peptide drugs list, please feel free to contact us!</p> <p>If you need any kinds of peptide service, please contact us, as one of the peptide synthesis suppliers, KS-V peptide is willing to offer you high quality products.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220824/10/peptide-library-construction-and-screening.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220824/10/peptide-library-construction-and-screening.jpg" alt="peptide-library-construction-and-screening.jpg" /></a></p> </description>
<pubDate>2023-04-23T11:08:05+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/9HuLcu20bCU</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/9HuLcu20bCU#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/9HuLcu20bCU</guid>
</item>
<item>
<title>Custom Peptide Synthesis(2023年05月04日)</title>
<description><p><a href="https://www.difficultpeptide.com/custom-peptide-synthesis/">https://www.difficultpeptide.com/custom-peptide-synthesis/</a></p> <p>KS-V Peptide has always been committed to the research and development of advanced peptide synthesis technology. We have owned a number of peptide synthetics technologies and have been one of the top suppliers of custom peptide synthesis services in China today. Comprehensive quality control management and strict testing services ensure the high-quality delivery of each peptide. Our customers have covered world-renowned universities, research institutes, and biomedical companies.</p> <p>CUSTOM PEPTIDE SYNTHESIS SERVICES WE CAN PROVIDE</p> <p>Peptide display library/array synthesis long peptide synthesis</p> <p>Large-scale peptide synthesis</p> <p>D-type amino acid peptide synthesis service</p> <p>Recombinant peptide synthesis</p> <p>Peptide synthesis</p> <p>Glycopeptide Synthesis Service. Oligopeptide synthesis</p> <p>Bicyclic peptide synthesis service</p> <p>A variety of antigen peptides and dendrimers</p> <p>METHODS OF PEPTIDE SYNTHESIS<br /> We can provide peptide synthesis from mg to kg of high-quality compound synthesis, such as synthesis of APl intermediates, reference</p> <p>compounds, metabolites, and impurities expansion to non-GLP drug substances, as well as the development and synthesis of PROTAC drug molecules.</p> <p>Main Methods:</p> <p>1. Solid-phase peptide synthesis is used to prepare biologically active peptides, including long peptides, difficult peptides, and hydrophobic peptides.</p> <p>2. Biosynthesis provides different types of peptide modifications and customized peptides for diagnostic and therapeutic applications.</p> <p>SERVICE CONTENT OF OUR PEPTIDE SYNTHESIS<br /> Free peptide consultation and design<br /> Custom peptides according to your requirements such as ultra-long peptide.<br /> Peptide modification<br /> Mass spectrometry and HPLC chromatogram confirm purity and characteristics<br /> Provided as a lyophilized powder</p> <p>QUALITY CONTROL OF OUR CUSTOM PEPTIDE SYNTHESIS<br /> After peptide synthetics, each type of peptide synthesized is routinely analyzed by LC-MS, MALD-MSor HPLC to confirm the quality of the customized peptide.</p> <p>Mass spectrometry</p> <p>All peptides were analyzed by MALDl-MS to determine the molecular weight of the synthetic peptides.</p> <p>High-performance liquid chromatography</p> <p>MALDI is an excellent method to determine the presence of the desired product but it is not sufficient to determine purity. Therefore, all non-crude peptides must be analyzed by reversed-phase HPLC(RP-HPLC) to determine the purity. Other QC analyses can be performed, such as amino acid analysis, NMR, CE, and peptide content determination to confirm the quality of customized peptides.</p> <p>Other quality control (optional)</p> <p>Chromatography (HPLC,TLC,GC,IC)</p> <p>Chromatography combined with mass spectrometry (LC-MS/ESI)Metal analysis(AAS, ICP,ICP-MS)</p> <p>Titration (acid-base titration, Karl Fischer titration)</p> <p>Spectroscopy (Uv-Vis, IR, NMR)</p> <p>Elemental analysis</p> <p>Amino acid analysis</p> <p>Peptide sequencing</p> <p>WHY CHOOSE PEPTIDE SYNTHESIS SERVICE of KS-V PEPTIDE<br /> As a professional provider of peptides synthesis in China, KS-V Peptide aims to be the top reliable peptide synthesis company by offering excellent peptide synthesis services that featured by the following advantages:<br /> Consistent result: the success rate of delivering high-quality peptides stored in argon stabilizers> 99%;<br /> Not limited to short or long peptides, chemical or recombinant peptide technology;<br /> Lots of conjugation, modification, and labeling;<br /> Quality control: all peptides are analyzed by MS and HPLCFast turnaround;<br /> Free peptide design tool and competitive custom peptide synthesis price.</p> <p>As a peptide synthesis supplier, we provide peptide library services, peptide toxin, peptide service, peptide analysis services, custom large scale peptide synthesis, etc. Contact us to know custom peptide synthesis price or custom peptides synthesis applications.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" alt="peptides-we-can-provide.jpg" /></a></p> </description>
<pubDate>2023-04-23T11:07:36+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ikymFD05q4C</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ikymFD05q4C#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ikymFD05q4C</guid>
</item>
<item>
<title>KS-V PEPTIDE CULTURE(2023年05月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/company-culture.html">https://www.difficultpeptide.com/company-culture.html</a></p> <p>KS-V Peptide Culture<br /> Company Mission</p> <p>KSVP focuses on high-quality peptide products and services and is committed to promoting the research and development of innovative peptide and protein drugs.</p> <p>Company Vision</p> <p>Establish a standard system for the industrialization of the custom peptide synthesis service</p> <p>Promote the development of domestic innovative peptide drugs</p> <p>Build International Peptide Center in Hefei</p> <p>Values</p> <p>Safety first, quality first, efficient innovation, serving the society</p> <p>For more information about custom peptide manufacturing and epigenetic histone modification, please feel free to contact us!</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" alt="engineering-laboratory-of-peptide-drugs-company-culture.jpg" /></a></p> </description>
<pubDate>2023-04-23T11:07:09+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6MxeGhiztv6</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6MxeGhiztv6#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6MxeGhiztv6</guid>
</item>
<item>
<title>PEPTIDE SERVICES CENTER(2023年05月02日)</title>
<description><p><a href="https://www.difficultpeptide.com/820959-17-9_sp">https://www.difficultpeptide.com/820959-17-9_sp</a></p> <p>ABOUT KS-V PEPTIDE<br /> MORE ABOUT KS-V PEPTIDE</p> <p>ABOUT KS-V PEPTIDE<br /> Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>Besides, as one of the professional custom peptide synthesis companies in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.</p> <p>For more information about kurtoxin and epigenetics histone modification, please feel free to contact us!</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220818/09/custom-peptide_1660787778.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220818/09/custom-peptide_1660787778.jpg" alt="custom-peptide_1660787778.jpg" /></a></p> </description>
<pubDate>2023-04-23T11:06:39+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VrogGA6fzr1</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VrogGA6fzr1#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VrogGA6fzr1</guid>
</item>
<item>
<title>WHAT DOES UBIQUITIN DO?(2023年05月01日)</title>
<description><p><a href="https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html">https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html</a></p> <p>Ubiquitin is a highly conserved protein widely found in nuclear cells. It cooperates with ubiquitin activating enzyme (E1), ubiquitin conjugating enzyme (E2), and ubiquitin ligase (E3) to achieve ubiquitination and modification of specific proteins, and finally achieves the removal of aging, damaged and misfolded proteins, and is conducive to maintaining The normal physiological function of cells plays a very important role. In addition, some ubiquitination reactions can also achieve functional regulation independent of protein degradation.</p> <p>As a custom peptide company, we provide pre clinical trials, peptide toxin, peptide service, na+ channel blocker, multi ubiquitination, different types of ubiquitination, etc. Want to know ubiquitination function and what is the role of ubiquitin.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20220905/15/long-peptide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20220905/15/long-peptide.jpg" alt="long-peptide.jpg" /></a></p> </description>
<pubDate>2023-04-23T11:05:54+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/MJuKzdb38w3</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/MJuKzdb38w3#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/MJuKzdb38w3</guid>
</item>
<item>
<title>UB AMC(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/ub-amc/">https://www.difficultpeptide.com/products/ub-amc/</a></p> <p>Ubiquitin AMC is prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin.</p> <p>SPECIFICATION OF UB AMC<br /> CATU1010<br /> Product NameUb-AMC<br /> Purity≥95% by HPLC analysis<br /> AppearanceLyophilized powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> IntroductionUbiquitin-AMC is a fluorogenic substrate for a wide range of deubiquitinating enzymes (DUBs), including ubiquitin C-terminal hydrolases (UCHs) and ubiquitin-specific proteases (USPs). It is a particularly useful reagent for the study of deubiquitinating activity where detection sensitivity or continuous monitoring of activity is essential.</p> <p>APPLICATION OF UB AMC<br /> Can be used for the following applications:</p> <p>1. Substrate for deubiquitinylating enzyme activity assays.</p> <p>2. Identification/confirmation of enzyme deubiquitinylation activity.</p> <p>3. Investigation of deconjugating enzyme-substrate specificity in comparison with alternative UBL substrates.</p> <p>There are many peptide manufacturing companies in China, but we are one of the best choices for you.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-ub-amc.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-ub-amc.jpg" alt="application-of-ub-amc.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:25:22+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/H2Zr0kpJgt8</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/H2Zr0kpJgt8#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/H2Zr0kpJgt8</guid>
</item>
<item>
<title>SYN AKE(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/syn-ake/">https://www.difficultpeptide.com/products/syn-ake/</a></p> <p>Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in venom.</p> <p>SPECIFICATION OF SYN AKE<br /> Purity(HPLC)≥99%<br /> Content≥75%<br /> Acetic Acid≤15%<br /> Moisture≤8%<br /> 20% below market price<br /> 10+kg per month<br /> Fast delivery</p> <p>APPLICATION OF SYN AKE<br /> Product NameSYN-AKE / Dipeptide Diaminobutyroyl Benzylamide<br /> CAS No823202-99-9Molecular FormulaC19H29N5O3(C2H4O2)2<br /> Sequencebeta-Ala-Pro-Dab-NHBzlMolecular Weight495.569g/mol<br /> Package1g, 10g, 100g, 500g, customizableAppearanceWhite Freeze-dried Powder<br /> ApplicationCosmetic raw materialsStorage2~8℃</p> <p>Efficacy and Mechanism of Action:</p> <p>Tripeptide-3 (sequence: beta-Ala-Pro-Dab-NHBn-2-Acetate), also known as dipeptide diaminobutyryl benzylamine diacetate or syn ake peptide, mimics the action of wagering-1, a peptide found in venom. V snake Tropidolaemus wagleri. Tripeptide-3 acts on the postsynaptic membrane and is a reversible antagonist of the acetylcholine receptor.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged difficult peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>If you want to know more details of modification of histones, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" alt="application-of-syn-ake.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:24:50+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/L3lGrgBlje9</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/L3lGrgBlje9#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/L3lGrgBlje9</guid>
</item>
<item>
<title>SYN AKE(2023年03月)</title>
<description><p><a href="https://www.difficultpeptide.com/products/syn-ake/">https://www.difficultpeptide.com/products/syn-ake/</a></p> <p>Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimics the action of wagering-1, a peptide found in venom.</p> <p>SPECIFICATION OF SYN AKE<br /> Purity(HPLC)≥99%<br /> Content≥75%<br /> Acetic Acid≤15%<br /> Moisture≤8%<br /> 20% below market price<br /> 10+kg per month<br /> Fast delivery</p> <p>APPLICATION OF SYN AKE<br /> Product NameSYN-AKE / Dipeptide Diaminobutyroyl Benzylamide<br /> CAS No823202-99-9Molecular FormulaC19H29N5O3(C2H4O2)2<br /> Sequencebeta-Ala-Pro-Dab-NHBzlMolecular Weight495.569g/mol<br /> Package1g, 10g, 100g, 500g, customizableAppearanceWhite Freeze-dried Powder<br /> ApplicationCosmetic raw materialsStorage2~8℃</p> <p>Efficacy and Mechanism of Action:</p> <p>Tripeptide-3 (sequence: beta-Ala-Pro-Dab-NHBn-2-Acetate), also known as dipeptide diaminobutyryl benzylamine diacetate or syn ake peptide, mimics the action of wagering-1, a peptide found in venom. V snake Tropidolaemus wagleri. Tripeptide-3 acts on the postsynaptic membrane and is a reversible antagonist of the acetylcholine receptor.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged difficult peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>If you want to know more details of modification of histones, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/16/application-of-syn-ake.jpg" alt="application-of-syn-ake.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:23:20+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/FsvD3B8wcOL</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/FsvD3B8wcOL#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/FsvD3B8wcOL</guid>
</item>
<item>
<title>SHK TOXIN(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/shk-toxin/">https://www.difficultpeptide.com/products/shk-toxin/</a></p> <p>Various KV K+ channels. Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.</p> <p>SPECIFICATION OF SHK TOXIN<br /> CATK1010-V<br /> CAS NO.172450-46-3<br /> Product NameShK Toxin<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4055 Da<br /> Molecular formulaC169H274N54O48S7<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceRSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32)</p> <p>APPLICATION OF SHK TOXIN<br /> ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and custom peptide library suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biological technology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-shk-toxin.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-shk-toxin.jpg" alt="application-of-shk-toxin.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:22:51+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/isIp10qbHGR</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/isIp10qbHGR#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/isIp10qbHGR</guid>
</item>
<item>
<title>SEMAGLUTIDE AND IMPURITY(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/semaglutide-and-impurity/">https://www.difficultpeptide.com/products/semaglutide-and-impurity/</a></p> <p>Semaglutide Peptide for Sale</p> <p>"Natural semaglutide is a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which is used in combination with diet and exercise in the therapy of type 2 diabetes, either alone or in combination with other antidiabetic agents."</p> <p>SPECIFICATION OF SEMAGLUTIDE AND IMPURITY<br /> CAS NO.910463-68-2<br /> Product NameSemaglutide<br /> Purity(HPLC)98%<br /> AppearanceWhite powder<br /> Molecular weight4114 g/mol<br /> Molecular formulaC187H291N45O59</p> <p>APPLICATION OF SEMAGLUTIDE AND IMPURITY<br /> Indication:<br /> Semaglutide is a recombinant DNA-produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which is used in combination with diet and exercise in the therapy of type 2 diabetes, either alone or in combination with other antidiabetic agents.</p> <p>Efficacy and mechanism of action<br /> long-acting human glucagon-like peptide-1 (GLP-1) analog developed by Novo Nordisk was subcutaneously injected once a week. It was approved by the FDA for marketing in December 2017 under the trade name Ozempic.</p> <p>Note: All products of Hefei KS-V Peptide CDMO are for scientific research only, not for clinical trials.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and custom peptide synthesis china suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-semaglutide-and-impurity.png" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-semaglutide-and-impurity.png" alt="application-of-semaglutide-and-impurity.png" /></a></p> </description>
<pubDate>2023-03-03T16:22:25+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zkBGtorgq02</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zkBGtorgq02#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zkBGtorgq02</guid>
</item>
<item>
<title>PSALMOTOXIN 1(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/psalmotoxin-1/">https://www.difficultpeptide.com/products/psalmotoxin-1/</a></p> <p>ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2</p> <p>SPECIFICATION OF PSALMOTOXIN 1<br /> CATO1120-V<br /> CAS NO./<br /> Product NamePsalmotoxin 1<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4689.5 Da<br /> Molecular formulaC200H312N62O57S6<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceEDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33)</p> <p>APPLICATION OF PSALMOTOXIN 1<br /> Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide synthesis china that inhibits cation currents mediated by acid-sensing ion channels (ASIC).</p> <p>More details of toxicological analysis, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-psalmotoxin-1.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-psalmotoxin-1.jpg" alt="application-of-psalmotoxin-1.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:21:06+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/aGybIZd1Ll2</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/aGybIZd1Ll2#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/aGybIZd1Ll2</guid>
</item>
<item>
<title>PROTOXIN II(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/protoxin-ii/">https://www.difficultpeptide.com/products/protoxin-ii/</a></p> <p>NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.</p> <p>SPECIFICATION OF PROTOXIN II<br /> CATN1030-V<br /> CAS NO.165168-50-3<br /> Product NameProtoxin II<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4054.85 Da<br /> Molecular formulaC169H274N54O48S7<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceRSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32)</p> <p>APPLICATION OF PROTOXIN II<br /> Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.</p> <p>As one of peptide synthesis companies, we can offer kinds of related products for sale, anything you need, please leave us a message.</p> <p>More kinds of peptide service, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-protoxin-ii.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-protoxin-ii.jpg" alt="application-of-protoxin-ii.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:20:40+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/294hGZbYHu1</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/294hGZbYHu1#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/294hGZbYHu1</guid>
</item>
<item>
<title>PLTX II(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/pltx-ii/">https://www.difficultpeptide.com/products/pltx-ii/</a></p> <p>SNX482<br /> Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective exocytosis inhibitor. Shows insecticidal effects in vivo.</p> <p>SPECIFICATION OF PLTX II<br /> CATC1100-V<br /> CAS NO./<br /> Product NamePLTX-II (PLTX-II, presynaptic voltage-gated Ca2+ channel blocker)<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight5108.73<br /> Molecular formulaC208H313N61O70S10<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceADCSATGDTCDHTKKCCDDCYTCRCGTPWGANCRCDYYKARCDT (Modifications: C-terminal amide; Thr-44 = O-palmitoyl; Disulfide bonds: 3-17, 10-23, 16-35, 20-42, 25-33)</p> <p>APPLICATION OF PLTX II<br /> PLTX II, a presynaptic calcium channel blocker in Drosophila isolated from the plectrums spider venom, is a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus</p> <p>If you want to know more kinds of custom polypeptides, please visit our website.</p> <p>More applications of peptides synthesis, please visit contact us.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-pltx-ii.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-pltx-ii.jpg" alt="application-of-pltx-ii.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:20:14+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VqucRUs5WxB</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VqucRUs5WxB#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/VqucRUs5WxB</guid>
</item>
<item>
<title>PLECANATIDE(2023年03月03日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/plecanatide/">https://www.difficultpeptide.com/products/plecanatide/</a></p> <p>Polypeptides is a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation and irritable bowel syndrome.</p> <p>SPECIFICATION OF PLECANATIDE<br /> CAS NO.467426-54-6<br /> Product NamePlecanatide<br /> Purity(HPLC)98%<br /> AppearanceWhite powder<br /> Molecular weight1681.9 g/mol<br /> Molecular formulaC65H104N18O26S4<br /> Storage-20℃</p> <p>APPLICATION OF PLECANATIDE<br /> Indication:<br /> Plecanatide tablets is a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation and irritable bowel syndrome.</p> <p>Note: All products of Hefei KS V Peptide are for scientific research only, not for clinical trials.</p> <p>As a peptide company, we can offer kinds of related products for sale, if you have needs, please contact us.<br /> <a href="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-plecanatide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210715/09/application-of-plecanatide.jpg" alt="application-of-plecanatide.jpg" /></a></p> </description>
<pubDate>2023-03-03T16:19:20+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/5aGU6X4duh5</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/5aGU6X4duh5#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/5aGU6X4duh5</guid>
</item>
<item>
<title>Kaliotoxin(2023年01月19日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/kaliotoxin/">https://www.difficultpeptide.com/products/kaliotoxin/</a></p> <p>SPECIFICATION OF KALIOTOXIN</p> <p>CATK1070-V<br /> CAS NO.145199-73-1<br /> Product NameKaliotoxin<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4149.89 Da<br /> Molecular formulaC171H283N55O49S6<br /> SourceSynthetic route peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceGVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35)</p> <p>APPLICATION OF KALIOTOXIN<br /> Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide custom synthesis china suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-kaliotoxin.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-kaliotoxin.jpg" alt="application-of-kaliotoxin.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:05:03+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/EAx7k3yPVNe</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/EAx7k3yPVNe#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/EAx7k3yPVNe</guid>
</item>
<item>
<title>Iberiotoxin(2023年01月17日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/iberiotoxin/">https://www.difficultpeptide.com/products/iberiotoxin/</a></p> <p>IBERIOTOXIN<br /> KCa1.1 K+ channels, Iberiotoxin is a potent selective blocker of the high conductance Ca2+-activated K+ channels (maxi-K).</p> <p>SPECIFICATION OF IBERIOTOXIN</p> <p>CATK1060-V<br /> CAS NO.129203-60-7<br /> Product NameIberiotoxin<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4230.9 Da<br /> Molecular formulaC179H276N50O56S7<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid)</p> <p>APPLICATION OF IBERIOTOXIN<br /> Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.</p> <p>Hefei KS-V peptide biological technology Co.,Ltd. is a high-tech enterprise focusing on Peptide CDMO drug discovery and innovative technology services. The founding team is from Tsinghua University and University of Science and Technology of China, and the management team has rich experience in innovative drug R&D and technical services. With peptide as the core, the company has built a core peptide seed bank, including DNA coding and combinatorial chemical peptide library, phage display bicyclic peptide library, etc. , in vitro functional screening (especially membrane protein targets), structure analysis, pharmacological efficacy, pharmacokinetics and other core technology platforms, can provide comprehensive services for pharmaceutical companies, biotechnology companies, and scientific research units.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-iberiotoxin.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-iberiotoxin.jpg" alt="application-of-iberiotoxin.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:04:36+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lWaic9IhRKf</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lWaic9IhRKf#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lWaic9IhRKf</guid>
</item>
<item>
<title>Huwentoxin Iv(2023年01月15日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/huwentoxin-iv/">https://www.difficultpeptide.com/products/huwentoxin-iv/</a></p> <p>HUWENTOXIN IV<br /> TTX-sensitive Na+ channels, Huwentoxin-IV specifically inhibits the neuronal tetrodotoxin-sensitive (TTX-S) voltage-gated Na+ channel (IC50 = 30 nM) in adult rat dorsal root ganglion neurons, while having no significant effect on the tetrodotoxin-resistant (TTX-R) voltage-gated Na+ channel1-3.</p> <p>SPECIFICATION OF HUWENTOXIN IV</p> <p>CATN1020-V<br /> CAS NO.526224-73-7<br /> Product Namehuwentoxin IV<br /> Purity> 98%<br /> Form/StateLyophilized powder<br /> SolubilitySoluble in water<br /> Molecular weight4107.20 Da<br /> Molecular formulaC174H277N51O52S6<br /> SourceSynthetic peptide<br /> StorageShipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.<br /> Storage of solutionsUp to two weeks at 4°C or three months at -20°C.<br /> SequenceECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI (Disulfide bonds: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31)</p> <p>APPLICATION OF HUWENTOXIN IV<br /> Huwentoxin-IV, a component of tarantula venom, potently blocks sodium channels and is an attractive scaffold for engineering a Nav1.7-selective molecule</p> <p>As the best peptide supplier, we will do our best to provide more types of related products for sale, anything you need, please contact us.</p> <p>If you want to know more details of epigenetic histone modification, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-huwentoxin-iv.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-huwentoxin-iv.jpg" alt="application-of-huwentoxin-iv.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:04:07+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/XQEwapIWire</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/XQEwapIWire#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/XQEwapIWire</guid>
</item>
<item>
<title>H4K8ac(2023年01月13日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/h4k8ac/">https://www.difficultpeptide.com/products/h4k8ac/</a></p> <p>H4K8AC<br /> Synthesized histone H4 peptide corresponding to residues within 1-102 of human histone H4 with acetylation K8 modification.</p> <p>SPECIFICATION OF H4K8AC</p> <p>CATH4201<br /> Product NameHistone H4-K8ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGK(ac)GL GKGGAKRHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K8AC<br /> H4K8ac, representing an epigenetic modification to the DNA packaging protein histone H4, is a mark indicating the acetylation at the 8th lysine residue of the histone H4 protein. It has been implicated in the prevalence of malaria.</p> <p>As a chinese peptide company, we will do our best to meet all the needs of customers.</p> <p>If you want to know more about chemical structure identification, please visit our website.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k8ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k8ac.jpg" alt="application-of-h4k8ac.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:03:40+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/efLXTEt6ype</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/efLXTEt6ype#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/efLXTEt6ype</guid>
</item>
<item>
<title>H4K20ac(2023年01月11日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/h4k20ac/">https://www.difficultpeptide.com/products/h4k20ac/</a></p> <p>H4K20AC<br /> Synthesized histone H4 peptide corresponding to residues within 1-102 of human histone H4 with acetylation K20 modification.</p> <p>SPECIFICATION OF H4K20AC</p> <p>CATH4204<br /> Product NameHistone H4-K20ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GKGGAKRHRK(ac) VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K20AC<br /> Modification of histones are associated with distinct transcription states and serve as heritable epigenetic markers for chromatin structure and function. H4K20ac is associated with gene repression in human cells. Unlike H3K9me3, a constitutive heterochromatin mark, H4K20ac was less associated with TSSs of completely silenced genes (those with no mRNA expression), suggesting that H4K20ac may play a role in repressing transcribed genes rather than in assisting with heterochromatin formation to induce a fully silent state, possibly preventing methylation on the same residue.</p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k20ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k20ac.jpg" alt="application-of-h4k20ac.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:03:13+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/Q0Yutv0dAi3</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/Q0Yutv0dAi3#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/Q0Yutv0dAi3</guid>
</item>
<item>
<title>H4K16ac(2023年01月09日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/h4k16ac/">https://www.difficultpeptide.com/products/h4k16ac/</a></p> <p>SPECIFICATION OF H4K16AC</p> <p>CATH4203<br /> Product NameHistone H4-K16ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GKGGAK(ac)RHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K16AC<br /> H4K16ac antibody is an epigenetic modification to the DNA packaging protein Histone H4. It is a mark that indicates the acetylation at the 16th lysine residue of the histone H4 protein. H4K16ac is unusual in that it has both transcriptional activation AND repression activities. The loss of H4K20me3 along with a reduction of H4K16ac is a strong indicator of cancer.</p> <p>Acetylation of histone H4 on lysine 16 (H4K16ac) is especially important for chromatin structure and function in a variety of eukaryotes and is catalyzed by specific histone lysine acetyltransferases (HATs). H4K16 is particularly interesting because this is the only acetylatable site of the H4 N-terminal tail, and can influence the formation of a compact higher-order chromatin structure. Hypoacetylation of H4K16 appears to cause delayed recruitment of DNA repair proteins to sites of DNA damage in a mouse model of the premature aging syndrome Hutchinson Gilford progeria. H4K16ac also has roles in transcriptional activation and the maintenance of euchromatin.</p> <p>As one of the best peptide synthesis companies in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/17/application-of-h4k16ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/17/application-of-h4k16ac.jpg" alt="application-of-h4k16ac.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:02:46+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/4SwhVtapjTO</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/4SwhVtapjTO#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/4SwhVtapjTO</guid>
</item>
<item>
<title>H4K12ac(2023年01月07日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/h4k12ac/">https://www.difficultpeptide.com/products/h4k12ac/</a></p> <p>SPECIFICATION OF H4K12AC</p> <p>CATH4202<br /> Product NameHistone H4-K12ac<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GK(ac)GGAKRHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF H4K12AC<br /> H4K12ac is an epigenetic modification to the DNA packaging protein histone H4. It is a mark that indicates the acetylation at the 12th lysine residue of the histone H4 protein. H4K12ac is involved in learning and memory. It is possible that restoring this modification could reduce age-related decline in memory.</p> <p>As one of reputable peptide companies, we can offer kinds of peptides synthesis for sale, anything you need, please leave us a message.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k12ac.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h4k12ac.jpg" alt="application-of-h4k12ac.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:02:20+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/c6Mn3PZJ06c</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/c6Mn3PZJ06c#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/c6Mn3PZJ06c</guid>
</item>
<item>
<title>Common Histone H4(2023年01月05日)</title>
<description><p><a href="https://www.difficultpeptide.com/products/h4/">https://www.difficultpeptide.com/products/h4/</a></p> <p>SPECIFICATION OF HISTONE H4</p> <p>CATH4100<br /> Product NameHistone H4<br /> Purity≥95% by HPLC analysis<br /> AppearanceWhite powder<br /> UsageResearch use only<br /> StorageShipping at room temperature.<br /> Upon delivery aliquot.<br /> Stored at -20°C or -80°C.<br /> Avoid freeze/thaw cycle.<br /> SequenceSGRGKGGKGL GKGGAKRHRK VLRDNIQGIT KPAIRRLARR GGVKRISGLI YEETRGVLKV FLENVIRDAV TYTEHAKRKT VTAMDVVYAL KRQGRTLYGF GG</p> <p>APPLICATION OF HISTONE H4<br /> Histone H4 is one of the five main human histone h4 protein involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H4 is involved with the structure of the nucleosome of the 'beads on a string' organization. Histone H4 is an important protein in the structure and function of chromatin, where its sequence variants and variable modification states are thought to play a role in the dynamic and long-term regulation of genes.</p> <p>Histone H4 is a 102 to 135 amino acid protein which shares a structural motif, known as the histone fold, formed from three a-helices connected by two loops. Histone proteins H3 and H4 bind to form an H3-H4 dimer, two of these H3-H4 dimers combine to form a tetramer. This tetramer further combines with two H2a-H2b dimers to form the compact Histone octamer core.</p> <p>Histone methylation occurs on arginine, lysine and histidine amino acids residues. Mono-, di- or tri-methylation has been discovered on histone H2A, H3 and H4. Histone methylation has been associated with various cellular functions such as transcription, DNA replication, and DNA damage response including repair, heterochromatin formation, and somatic cell reprogramming. Also methylation of histone H4 by PRMT1 was sufficient to permit subsequent acetylation on the N-terminal tail. However, acetylation of H4 inhibits its methylation by PRMT1, such as H4K20me2.</p> <p>Acetylation of histones is thought to relax condensed heterochromatin as the negative charge of acetyl groups can repel the DNA phosphate backbone charges, thus reducing the histone binding affinity for DNA. We can provide H4K5ac, H4K8ac, H4K12ac, H4K16ac, H4K20ac.</p> <p>If you want to know more details of histone h4 peptide, please visit our website.</p> <p>As one of custom peptide synthesis companies, we can offer kinds of related products for sale, anything you need, please leave us a message.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/15/application-of-histone-h4.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/15/application-of-histone-h4.jpg" alt="application-of-histone-h4.jpg" /></a></p> </description>
<pubDate>2023-01-05T12:01:55+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/fcwFNgU7AiW</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/fcwFNgU7AiW#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/fcwFNgU7AiW</guid>
</item>
<item>
<title>INTRODUCTION TO SBDD(2022年)</title>
<description><p><a href="https://www.difficultpeptide.com/introduction-to-sbdd.html">https://www.difficultpeptide.com/introduction-to-sbdd.html</a></p> <p>Ⅰ.What is SBDD?</p> <p>Structure based drug design (SBDD) is a drug design method based on molecular recognition from the three-dimensional structure of ligands and targets. According to drugs and their targets, such as receptors, enzymes, ion channels, nucleic acids, antigens and viruses, we can find and design reasonable drug molecules.</p> <p>Generally, the steps of SBDD include protein structure preparation, binding site recognition, ligand library preparation, docking and scoring function.</p> <p>Target is the prerequisite of drug design. The selection of reasonable drug target directly determines the success or failure of drug development. The three-dimensional structure of the target can often be obtained by computer model methods such as X-ray crystallography, multi-dimensional nuclear magnetic resonance or homologous protein structure prediction. Secondly, the interaction model between drug and receptor is measured by experimental means or studied by computational method, and the rational drug design is carried out on this basis; In addition to considering the structural characteristics of drugs and receptors, it is also necessary to consider the influence of factors such as drug solubility, toxicity and metabolic process. Reasonable drug design usually requires 10-15 cycles to find the "most suitable" drug molecules.</p> <p>Ⅱ. Advantages and disadvantages of SBDD Technology Platform</p> <p>1.Advantages: low screening cost. Candidate drugs can be obtained from a small number of compounds; It can significantly improve the hit rate of drug discovery; It can directly predict the drug receptor binding energy.<br /> 2.<br /> 3.Deficiency: This design requires a complete and clear three-dimensional structure of the target; it only considers the binding strength of the drug and the receptor, and cannot predict the efficacy of the drug; the speed is slow.</p> <p>As one of the most professional peptide manufacturing companies, we provide custom peptide synthesis china, g2s services, histone h3, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210628/11/engineering-laboratory-of-peptide-drugs6.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210628/11/engineering-laboratory-of-peptide-drugs6.jpg" alt="engineering-laboratory-of-peptide-drugs6.jpg" /></a></p> </description>
<pubDate>2022-06-09T10:52:58+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zRHbWRl1L7L</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zRHbWRl1L7L#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/zRHbWRl1L7L</guid>
</item>
<item>
<title>GENE TO STRUCTURE(2022年)</title>
<description><p><a href="https://www.difficultpeptide.com/gene-to-structure/">https://www.difficultpeptide.com/gene-to-structure/</a></p> <p>As a professional peptide company in China, we can provide innovative drugs from gene to protein, from gene to structure, from structure to lead compound to new drug preclinical candidate drug and other services, and efficiently promote the discovery of innovative drug candidates.</p> <p>OUR ADVANTAGES IN GENE TO STRUCTURE<br /> Our Advantages in Gene to Structure<br /> We have several methods which are used to determine the structure of a biomacromolecule, including Nuclear Magnetic Resonance (NMR) spectroscopy and Cryogenic Electron Microscopy (cryo-EM).</p> <p>We have the most complete and state-of-the-art platform and professional knowledge cluster.</p> <p>After finishing the study, KS-V peptide company will provide you with the confidential structural determination report:</p> <p>–A report of the process of the different phase</p> <p>–Structure confirmation</p> <p>As one of the most professional peptide pharmaceutical companies, we provide custom peptide synthesis china, g2s services, epigenetic histone modification, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210719/14/peptides-we-can-provide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210719/14/peptides-we-can-provide.jpg" alt="peptides-we-can-provide.jpg" /></a></p> </description>
<pubDate>2022-06-09T10:52:36+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lAOixEu9768</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lAOixEu9768#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/lAOixEu9768</guid>
</item>
<item>
<title>PEPTIDE DRUG DISCOVERY(2022年)</title>
<description><p><a href="https://www.difficultpeptide.com/drug-discovery/">https://www.difficultpeptide.com/drug-discovery/</a></p> <p>With a team of experienced experts, advanced research equipment, and proprietary methods, KS-V Peptides provides a one-stop service for your early peptide drug discovery and accelerates your drug development process.</p> <p>For CRO and drug discovery services, we are open to flexible business arrangements for our contract research and drug discovery services, which can include: Peptide Library Construction; PDC Drugs and Structure Confirmation.</p> <p>KS-V Peptides committed to providing reliable contract research services to our client's drug discovery processes. We can also provide you with quality peptide APIs based on the above services. Comprehensive drug development services are designed to reduce your cost and time and help you discover a list of peptide drugs .</p> <p>What is Peptide Drug?<br /> Peptide drug refers to a peptide having a specific therapeutic effect extracted by chemical synthesis genetic recombination or animal or plant and is a specific application of the peptide in the field of medicine. The biological activity of the peptide is extensive and important, and it can be widely applied to the endocrine system, the immune system, the digestive system, the cardiovascular system, the blood system, the musculoskeletal system, etc.</p> <p>As drugs, peptides have many advantages, such as wide indications, high safety, and significant efficacy. With the continuous development of biotechnology, more and more peptide medications have been developed and applied in clinical practice.</p> <p>As one of the most professional peptide synthesis suppliers, we provide custom peptide synthesis china, custom large scale peptide synthesis, epigenetics histone modification, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210705/09/peptide-library-construction.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210705/09/peptide-library-construction.jpg" alt="peptide-library-construction.jpg" /></a><br /> <a href="https://www.difficultpeptide.com/uploads/image/20210802/16/pdc-drugs.png" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210802/16/pdc-drugs.png" alt="pdc-drugs.png" /></a><br /> <a href="https://www.difficultpeptide.com/uploads/image/20210802/16/structure-confirmation.png" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210802/16/structure-confirmation.png" alt="structure-confirmation.png" /></a></p> </description>
<pubDate>2022-06-09T10:52:15+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6RxkfFSuVus</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6RxkfFSuVus#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/6RxkfFSuVus</guid>
</item>
<item>
<title>CUSTOM PEPTIDE SYNTHESIS(2022年)</title>
<description><p><a href="https://www.difficultpeptide.com/custom-peptide-synthesis/">https://www.difficultpeptide.com/custom-peptide-synthesis/</a></p> <p>KS-V Peptide has always been committed to the research and development of advanced peptide synthesis technology. We have owned a number of peptide synthesis technologies and have been one of the top suppliers of custom peptide synthesis services in China today. Comprehensive quality control management and strict testing services ensure the high-quality delivery of each peptide. Our customers have covered world-renowned universities, research institutes, and biomedical companies.</p> <p>CUSTOM PEPTIDE SYNTHESIS SERVICES WE CAN PROVIDE</p> <p>Peptide display library/array synthesis long peptide synthesis</p> <p>Large-scale peptide synthesis</p> <p>D-type amino acid peptide synthesis service</p> <p>Recombinant peptide synthesis</p> <p>Peptide synthesis</p> <p>Glycopeptide Synthesis Service. Oligopeptide synthesis</p> <p>Bicyclic peptide synthesis service</p> <p>A variety of antigen peptides and dendrimers</p> <p>METHODS OF PEPTIDE SYNTHESIS<br /> We can provide peptide synthesis from mg to kg of high-quality compound synthesis, such as synthesis of APl intermediates, reference</p> <p>compounds, metabolites, and impurities expansion to non-GLP drug substances, as well as the development and synthesis of PROTAC drug molecules.</p> <p>Main Methods:</p> <p>1. Solid-phase peptide synthesis is used to prepare biologically active peptides, including long peptides, difficult peptides, and hydrophobic peptides.</p> <p>2. Biosynthesis provides different types of peptide modifications and customized peptides for diagnostic and therapeutic applications.</p> <p>SERVICE CONTENT OF OUR PEPTIDE SYNTHESIS<br /> Free peptide consultation and design</p> <p>Custom peptides according to your requirements such as ultra-long peptide.</p> <p>Peptide modification</p> <p>Mass spectrometry and HPLC chromatogram confirm purity and characteristics</p> <p>Provided as a lyophilized powder</p> <p>QUALITY CONTROL OF OUR CUSTOM PEPTIDE SYNTHESIS<br /> After peptide synthetics, each type of peptide synthesized is routinely analyzed by LC-MS, MALD-MSor HPLC to confirm the quality of the customized peptide.</p> <p>Mass spectrometry</p> <p>All peptides were analyzed by MALDl-MS to determine the molecular weight of the synthetic peptides.</p> <p>High-performance liquid chromatography</p> <p>MALDI is an excellent method to determine the presence of the desired product but it is not sufficient to determine purity. Therefore, all non-crude peptides must be analyzed by reversed-phase HPLC(RP-HPLC) to determine the purity. Other QC analyses can be performed, such as amino acid analysis, NMR, CE, and peptide content determination to confirm the quality of customized peptides.</p> <p>WHY CHOOSE PEPTIDE SYNTHESIS SERVICE of KS-V PEPTIDE<br /> As a professional provider of peptide synthesis in China, KS-V Peptide aims to be the top reliable peptide synthesis company by offering excellent peptide synthesis services that featured by the following advantages:</p> <p>Consistent result: the success rate of delivering high-quality peptides stored in argon stabilizers> 99%;</p> <p>Not limited to short or long peptides, chemical or recombinant peptide technology;</p> <p>Lots of conjugation, modification, and labeling;</p> <p>Quality control: all peptides are analyzed by MS and HPLCFast turnaround;</p> <p>Free peptide design tool and competitive custom peptide synthesis price.</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional peptide synthesis supplier, we provide custom peptide synthesis china, custom large scale peptide synthesis, peptide analysis services, peptide modification services, peptides synthesis, etc. Contact us to know custom peptides synthesis applications or more.<br /> <a href="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210705/11/peptides-we-can-provide.jpg" alt="peptides-we-can-provide.jpg" /></a></p> </description>
<pubDate>2022-06-09T10:51:52+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ETLQoulE4Sz</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ETLQoulE4Sz#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ETLQoulE4Sz</guid>
</item>
<item>
<title>KSVP CULTURE(2022年)</title>
<description><p><a href="https://www.difficultpeptide.com/company-culture.html">https://www.difficultpeptide.com/company-culture.html</a></p> <p>KSVP CULTURE</p> <p>Company Mission</p> <p>KSV Peptide focuses on high-quality peptide products and services and is committed to promoting the research and development of innovative peptide and protein drugs.</p> <p>Company Vision</p> <p>Establish a standard system for the industrialization of the custom peptide synthesis service</p> <p>Promote the development of domestic innovative peptide drugs</p> <p>Build International Peptide Center in Hefei</p> <p>Values</p> <p>Safety first, quality first, efficient innovation, serving the society</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional custom peptide company, we provide custom peptide synthesis china, peptide service, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210628/14/engineering-laboratory-of-peptide-drugs-company-culture.jpg" alt="engineering-laboratory-of-peptide-drugs-company-culture.jpg" /></a></p> </description>
<pubDate>2022-06-09T10:51:27+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ocOnVIz1L7Y</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ocOnVIz1L7Y#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/ocOnVIz1L7Y</guid>
</item>
<item>
<title>ABOUT KS-V PEPTIDE(2022年)</title>
<description><p><a href="https://www.difficultpeptide.com/">https://www.difficultpeptide.com/</a></p> <p>Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and peptide synthesis suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biotechnology companies, and scientific research institute.</p> <p>Besides, as one of the professional custom peptide synthesis companies in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional peptide synthesis supplier, we provide custom peptide synthesis china, na+ channel blocker, peptide service, kurtoxin, histone h4, etc. Contact us to know more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20210622/14/about-ks-v-peptide.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20210622/14/about-ks-v-peptide.jpg" alt="about-ks-v-peptide.jpg" /></a></p> </description>
<pubDate>2022-06-09T10:51:01+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/hvzRINkS8sV</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/hvzRINkS8sV#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/hvzRINkS8sV</guid>
</item>
<item>
<title>WHAT DOES UBIQUITIN DO?(2022年)</title>
<description><p><a href="https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html">https://www.difficultpeptide.com/1052-what-is-the-function-of-ubiquitination.html</a></p> <p>Ubiquitin is a highly conserved protein widely found in nuclear cells. It cooperates with ubiquitin activating enzyme (E1), multi ubiquitination conjugating enzyme (E2), and ubiquitin ligase (E3) to achieve ubiquitination and modification of specific proteins, and finally achieves the removal of aging, damaged and misfolded proteins, and is conducive to maintaining The normal physiological function of cells plays a very important role. In addition, some ubiquitination reactions can also achieve functional regulation independent of protein degradation.</p> <p>Want to know what is the role of ubiquitin and types of ubiquitination, please contact us.</p> <p>Hefei KS-V Peptide Biological Technology Co., Ltd. (KS-V Peptide) is a professional peptide synthesis supplier, we provide peptide synthesis china, na+ channel blocker, peptide service, semaglutide for sale, etc. Contact us to know ubiquitination function or more.</p> <p><a href="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h3k36me3.jpg" rel="nofollow"><img src="https://www.difficultpeptide.com/uploads/image/20211216/16/application-of-h3k36me3.jpg" alt="application-of-h3k36me3.jpg" /></a></p> </description>
<pubDate>2022-06-09T10:50:37+0900</pubDate>
<link>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/RSYgaEoYfPQ</link>
<author>difficultpeptide</author>
<comments>http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/RSYgaEoYfPQ#comments</comments>
<guid isPermaLink="true">http://pastport.jp/user/difficultpeptide/timeline/Hefei%20KS-V%20Peptide%20Biological%20Technology%20Co.%2C%20Ltd./event/RSYgaEoYfPQ</guid>
</item>
</channel>
</rss>